PDB entry 1lht

View 1lht on RCSB PDB site
Description: loggerhead sea turtle myoglobin (cyano-met)
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1995-02-01, released 1995-06-03
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.178
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Caretta caretta
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1lhta_
  • Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lhtA (A:)
    glsddewnhvlgiwakvepdlsahgqeviirlfqlhpetqerfakfknlttidalkssee
    vkkhgttvltalgrilkqknnheqelkplaeshatkhkipvkyleficeiivkviaekhp
    sdfgadsqaamkkalelfrndmaskykefgfqg