PDB entry 1lht

View 1lht on RCSB PDB site
Description: loggerhead sea turtle myoglobin (cyano-met)
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1995-02-01, released 1995-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Caretta caretta [TaxId:8467]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lhta_
  • Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lhtA (A:)
glsddewnhvlgiwakvepdlsahgqeviirlfqlhpetqerfakfknlttidalkssee
vkkhgttvltalgrilkqknnheqelkplaeshatkhkipvkyleficeiivkviaekhp
sdfgadsqaamkkalelfrndmaskykefgfqg