PDB entry 1lhs

View 1lhs on RCSB PDB site
Description: loggerhead sea turtle myoglobin (aquo-met)
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1995-02-01, released 1995-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Caretta caretta [TaxId:8467]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lhsa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lhsA (A:)
glsddewnhvlgiwakvepdlsahgqeviirlfqlhpetqerfakfknlttidalkssee
vkkhgttvltalgrilkqknnheqelkplaeshatkhkipvkyleficeiivkviaekhp
sdfgadsqaamkkalelfrndmaskykefgfqg