PDB entry 1lhs

View 1lhs on RCSB PDB site
Description: loggerhead sea turtle myoglobin (aquo-met)
Deposited on 1995-02-01, released 1995-06-03
The last revision prior to the SCOP 1.71 freeze date was dated 1995-06-03, with a file datestamp of 1995-06-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1lhs__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lhs_ (-)
glsddewnhvlgiwakvepdlsahgqeviirlfqlhpetqerfakfknlttidalkssee
vkkhgttvltalgrilkqknnheqelkplaeshatkhkipvkyleficeiivkviaekhp
sdfgadsqaamkkalelfrndmaskykefgfqg