PDB entry 1lhr

View 1lhr on RCSB PDB site
Description: Crystal Structure of Pyridoxal Kinase complexed with ATP
Class: transferase
Keywords: ALPHA-BETA structure, complexed with ATP, TRANSFERASE
Deposited on 2002-04-17, released 2003-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.193
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxal kinase
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lhra_
  • Chain 'B':
    Compound: Pyridoxal kinase
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lhrb_
  • Heterogens: ZN, K, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lhrA (A:)
    meeecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsd
    elqelydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqr
    ngegamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgp
    dtvvitssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaam
    llawthkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdi
    espeivvqatvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lhrA (A:)
    ecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsdelq
    elydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqrnge
    gamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgpdtv
    vitssnllsprgsdylmalgsqrtravvtqrirmemhkvdavfvgtgdlfaamllawthk
    hpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdiespeivv
    qatvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lhrB (B:)
    meeecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsd
    elqelydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqr
    ngegamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgp
    dtvvitssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaam
    llawthkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdi
    espeivvqatvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lhrB (B:)
    ecrvlsiqshvvrgyvgnraatfplqvlgfevdavnsvqfsnhtgyshwkgqvlnsdelq
    elydglklnhvnqydyvltgytrdksflamvvdivqelkqqnprlvyvcdpvmgdqrnge
    gamyvpddllpvyrekvvpvadiitpnqfeaelltgrkihsqeealevmdmlhsmgpdtv
    vitssnllsprgsdylmalgsqrtrapdgsvvtqrirmemhkvdavfvgtgdlfaamlla
    wthkhpnnlkvacektvsamhhvlqrtikcakaksgegvkpspaqlelrmvqskkdiesp
    eivvqatvl