PDB entry 1lhm

View 1lhm on RCSB PDB site
Description: the crystal structure of a mutant lysozyme c77(slash)95a with increased secretion efficiency in yeast
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1991-10-02, released 1992-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human lysozyme
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61626 (0-129)
    • conflict (76)
    • conflict (94)
  Domains in SCOPe 2.08: d1lhma_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lhmA (A:)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgavnaahlscsallqdniadavaaakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv