PDB entry 1lhk

View 1lhk on RCSB PDB site
Description: role of proline residues in human lysozyme stability: a scanning calorimetric study combined with x-ray structure analysis of proline mutants
Deposited on 1992-03-27, released 1994-01-31
The last revision prior to the SCOP 1.65 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.153
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.65: d1lhk__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lhk_ (-)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgavnachlscsallqdniapavacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv