PDB entry 1lhh

View 1lhh on RCSB PDB site
Description: role of proline residues in human lysozyme stability: a scanning calorimetric study combined with x-ray structure analysis of proline mutants
Deposited on 1992-03-27, released 1994-01-31
The last revision prior to the SCOP 1.69 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1lhh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lhh_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawpawrnrcqnrd
    vrqyvqgcgv