PDB entry 1lgy

View 1lgy on RCSB PDB site
Description: lipase ii from rhizopus niveus
Deposited on 1996-05-23, released 1996-12-23
The last revision prior to the SCOP 1.55 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1lgya_
  • Chain 'B':
    Domains in SCOP 1.55: d1lgyb_
  • Chain 'C':
    Domains in SCOP 1.55: d1lgyc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgyA (A:)
    kvvaattaqiqeftkyagiaataycrsvvpgnkwdcvqcqkwvpdgkiittftsllsdtn
    gyvlrsdkqktiylvfrgtnsfrsaitdivfnfsdykpvkgakvhagflssyeqvvndyf
    pvvqeqltahptykvivtghslggaqallagmdlyqreprlspknlsiftvggprvgnpt
    fayyvestgipfqrtvhkrdivphvppqsfgflhpgveswiksgtsnvqictseietkdc
    snsivpftsildhlsyfdinegscl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgyB (B:)
    kvvaattaqiqeftkyagiaataycrsvvpgnkwdcvqcqkwvpdgkiittftsllsdtn
    gyvlrsdkqktiylvfrgtnsfrsaitdivfnfsdykpvkgakvhagflssyeqvvndyf
    pvvqeqltahptykvivtghslggaqallagmdlyqreprlspknlsiftvggprvgnpt
    fayyvestgipfqrtvhkrdivphvppqsfgflhpgveswiksgtsnvqictseietkdc
    snsivpftsildhlsyfdinegscl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgyC (C:)
    kvvaattaqiqeftkyagiaataycrsvvpgnkwdcvqcqkwvpdgkiittftsllsdtn
    gyvlrsdkqktiylvfrgtnsfrsaitdivfnfsdykpvkgakvhagflssyeqvvndyf
    pvvqeqltahptykvivtghslggaqallagmdlyqreprlspknlsiftvggprvgnpt
    fayyvestgipfqrtvhkrdivphvppqsfgflhpgveswiksgtsnvqictseietkdc
    snsivpftsildhlsyfdinegscl