PDB entry 1lgr

View 1lgr on RCSB PDB site
Description: interactions of nucleotides with fully unadenylylated glutamine synthetase from salmonella typhimurium
Deposited on 1994-08-05, released 1994-11-30
The last revision prior to the SCOP 1.55 freeze date was dated 1994-11-30, with a file datestamp of 1994-12-07.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.233
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1lgr_ (-)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgr_ (-)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
    lmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgiadtvlf
    gpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyfpvppvd
    saqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiykyvvhnva
    hrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyiggvikhak
    ainalanpttnsykrlvppvmlaysarnrsasiripvvaspkarrievrfpdpaanpylc
    faallmagldgiknkihpgepmdipqvagsleealnaldldreflkaggvftdeaidayi
    alrreeddrvrmtphpvefelyysv