PDB entry 1lgq

View 1lgq on RCSB PDB site
Description: crystal structure of the fha domain of the chfr mitotic checkpoint protein
Deposited on 2002-04-16, released 2002-05-08
The last revision prior to the SCOP 1.71 freeze date was dated 2002-08-07, with a file datestamp of 2002-08-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.242
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1lgqa_
  • Chain 'B':
    Domains in SCOP 1.71: d1lgqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgqA (A:)
    mqpwgrllrlgaeegephvllrkrewtigrrrgcdlsfpsnklvsgdhcrivvdeksgqv
    tledtstsgtvinklkvvkkqtcplqtgdviylvyrknepehnvaylyesls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgqB (B:)
    mqpwgrllrlgaeegephvllrkrewtigrrrgcdlsfpsnklvsgdhcrivvdeksgqv
    tledtstsgtvinklkvvkkqtcplqtgdviylvyrknepehnvaylyesls