PDB entry 1lgb

View 1lgb on RCSB PDB site
Description: interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety
Class: complex(lectin/transferrin)
Keywords: complex(lectin/transferrin)
Deposited on 1994-01-07, released 1994-08-31
The last revision prior to the SCOP 1.73 freeze date was dated 1994-08-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 3.3 Å
R-factor: 0.21
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: legume isolectin II (alpha chain)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04122 (0-180)
      • conflict (15)
      • conflict (152)
      • conflict (167)
    Domains in SCOP 1.73: d1lgb.1
  • Chain 'B':
    Compound: legume isolectin II (beta chain)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12307
      • conflict (46)
    Domains in SCOP 1.73: d1lgb.1
  • Chain 'C':
    Compound: lactotransferrin (n2 fragment)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02788 (0-158)
      • conflict (109)
    Domains in SCOP 1.73: d1lgbc_
  • Heterogens: MN, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgbA (A:)
    tettsfsitkfgpdqpnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafngatnvltvsltyp
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lgbB (B:)
    etsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselavtsssn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgbB (B:)
    tsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselav
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgbC (C:)
    hyyavavvkkggsfqlnelqglkschtglrrtagwnvpigtlrpflnwtgppepieaava
    rffsascvpgadkgqfpnlcrlcagtgenkcafssqepyfsysgafkclkdgagdvafir
    estvfedlsdeaerdeyellcpdntrkpvdkfkdchlar