PDB entry 1lgb

View 1lgb on RCSB PDB site
Description: interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety
Deposited on 1994-01-07, released 1994-08-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 3.3 Å
R-factor: 0.21
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1lgb.1
  • Chain 'B':
    Domains in SCOP 1.55: d1lgb.1
  • Chain 'C':
    Domains in SCOP 1.55: d1lgbc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgbA (A:)
    tettsfsitkfgpdqpnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
    anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
    dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafngatnvltvsltyp
    n
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgbB (B:)
    tsytlnevvplkefvpewvrigfsattgaefaahevlswyfnselav
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgbC (C:)
    hyyavavvkkggsfqlnelqglkschtglrrtagwnvpigtlrpflnwtgppepieaava
    rffsascvpgadkgqfpnlcrlcagtgenkcafssqepyfsysgafkclkdgagdvafir
    estvfedlsdeaerdeyellcpdntrkpvdkfkdchlar