PDB entry 1lga

View 1lga on RCSB PDB site
Description: crystallographic refinement of lignin peroxidase at 2 angstroms
Deposited on 1992-12-08, released 1993-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.03 Å
R-factor: 0.15
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1lgaa_
  • Chain 'B':
    Domains in SCOP 1.61: d1lgab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgaA (A:)
    atcangktvgdasccawfdvlddiqanmfhggqcgaeahesirlvfhdsiaispameakg
    kfggggadgsimifdtietafhpnigldevvamqkpfvqkhgvtpgdfiafagavalsnc
    pgapqmnfftgrkpatqpapdglvpepfhtvdqiiarvndagefdelelvwmlsahsvaa
    vndvdptvqglpfdstpgifdsqffvetqfrgtlfpgsggnqgevesgmageiriqtdht
    lardsrtacewqsfvgnqsklvddfqfiflaltqlgqdpnamtdcsdviplskpipgngp
    fsffppgkshsdieqacaetpfpslvtlpgpatsvaripphka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgaB (B:)
    atcangktvgdasccawfdvlddiqanmfhggqcgaeahesirlvfhdsiaispameakg
    kfggggadgsimifdtietafhpnigldevvamqkpfvqkhgvtpgdfiafagavalsnc
    pgapqmnfftgrkpatqpapdglvpepfhtvdqiiarvndagefdelelvwmlsahsvaa
    vndvdptvqglpfdstpgifdsqffvetqfrgtlfpgsggnqgevesgmageiriqtdht
    lardsrtacewqsfvgnqsklvddfqfiflaltqlgqdpnamtdcsdviplskpipgngp
    fsffppgkshsdieqacaetpfpslvtlpgpatsvaripph