PDB entry 1lga

View 1lga on RCSB PDB site
Description: crystallographic refinement of lignin peroxidase at 2 angstroms
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1992-12-08, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.15
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lignin peroxidase
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgaa_
  • Chain 'B':
    Compound: Lignin peroxidase
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lgab_
  • Heterogens: NAG, CA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lgaA (A:)
    atcangktvgdasccawfdvlddiqanmfhggqcgaeahesirlvfhdsiaispameakg
    kfggggadgsimifdtietafhpnigldevvamqkpfvqkhgvtpgdfiafagavalsnc
    pgapqmnfftgrkpatqpapdglvpepfhtvdqiiarvndagefdelelvwmlsahsvaa
    vndvdptvqglpfdstpgifdsqffvetqfrgtlfpgsggnqgevesgmageiriqtdht
    lardsrtacewqsfvgnqsklvddfqfiflaltqlgqdpnamtdcsdviplskpipgngp
    fsffppgkshsdieqacaetpfpslvtlpgpatsvaripphka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lgaB (B:)
    atcangktvgdasccawfdvlddiqanmfhggqcgaeahesirlvfhdsiaispameakg
    kfggggadgsimifdtietafhpnigldevvamqkpfvqkhgvtpgdfiafagavalsnc
    pgapqmnfftgrkpatqpapdglvpepfhtvdqiiarvndagefdelelvwmlsahsvaa
    vndvdptvqglpfdstpgifdsqffvetqfrgtlfpgsggnqgevesgmageiriqtdht
    lardsrtacewqsfvgnqsklvddfqfiflaltqlgqdpnamtdcsdviplskpipgngp
    fsffppgkshsdieqacaetpfpslvtlpgpatsvaripphka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lgaB (B:)
    atcangktvgdasccawfdvlddiqanmfhggqcgaeahesirlvfhdsiaispameakg
    kfggggadgsimifdtietafhpnigldevvamqkpfvqkhgvtpgdfiafagavalsnc
    pgapqmnfftgrkpatqpapdglvpepfhtvdqiiarvndagefdelelvwmlsahsvaa
    vndvdptvqglpfdstpgifdsqffvetqfrgtlfpgsggnqgevesgmageiriqtdht
    lardsrtacewqsfvgnqsklvddfqfiflaltqlgqdpnamtdcsdviplskpipgngp
    fsffppgkshsdieqacaetpfpslvtlpgpatsvaripph