PDB entry 1lg2

View 1lg2 on RCSB PDB site
Description: crystal structure of human chitotriosidase in complex with ethylene glycol
Deposited on 2002-04-14, released 2002-09-18
The last revision prior to the SCOP 1.69 freeze date was dated 2002-09-18, with a file datestamp of 2002-09-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lg2A (A:)
    aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
    glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
    pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
    qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
    lgmptygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqk
    vpyifrdnqwvgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtl
    rqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lg2A (A:)
    aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
    glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
    pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
    qnldfvnlmaydfhgswekvtghnsplykraaslnvdaavqqwlqkgtpasklilgmpty
    grsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyifr
    dnqwvgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtlrqels