PDB entry 1lfk

View 1lfk on RCSB PDB site
Description: Crystal structure of OxyB, a Cytochrome P450 Implicated in an Oxidative Phenol Coupling Reaction During Vancomycin Biosynthesis
Class: oxidoreductase
Keywords: oxidative phenol coupling reaction p450 vancomycin, oxidoreductase
Deposited on 2002-04-11, released 2002-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: P450 monooxygenase
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lfka_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lfkA (A:)
    mseddprplhirrqgldpadellaagaltrvtigsgadaethwmatahavvrqvmgdhqq
    fstrrrwdprdeiggkgifrprelvgnlmdydppehtrlrrkltpgftlrkmqrmapyie
    qivndrldemeragspadliafvadkvpgavlcelvgvprddrdmfmklchghldaslsq
    krraalgdkfsryllamiarerkepgegmigavvaeygddatdeelrgfcvqvmlagddn
    isgmiglgvlamlrhpeqidafrgdeqsaqravdeliryltvpysptpriaredltlagq
    eikkgdsvicslpaanrdpalapdvdrldvtrepiphvafghgvhhclgaalarlelrtv
    ftelwrrfpalrladpaqdtefrlttpaygltelmvaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lfkA (A:)
    dprplhirrqgldpadellaagaltrvtaethwmatahavvrqvmgdhqqfstrrrwdpe
    lvgnlmdydppehtrlrrkltpgftlrkmqrmapyieqivndrldemeragspadliafv
    adkvpgavlcelvgvprddrdmfmklchghldaslsqkrraalgdkfsryllamiarerk
    epgegmigavvaeygddatdeelrgfcvqvmlagddnisgmiglgvlamlrhpeqidafr
    gdeqsaqravdeliryltvpysptpriaredltlagqeikkgdsvicslpaanrdpalap
    dvdrldvtrepiphvafghgvhhclgaalarlelrtvftelwrrfpalrladpaqdtefr
    lttpaygltelmvaw