PDB entry 1lfk

View 1lfk on RCSB PDB site
Description: crystal structure of oxyb, a cytochrome p450 implicated in an oxidative phenol coupling reaction during vancomycin biosynthesis
Deposited on 2002-04-11, released 2002-12-11
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.203
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1lfka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lfkA (A:)
    dprplhirrqgldpadellaagaltrvtigsgadaethwmatahavvrqvmgdhqqfstr
    rrwdprdeiggkgifrprelvgnlmdydppehtrlrrkltpgftlrkmqrmapyieqivn
    drldemeragspadliafvadkvpgavlcelvgvprddrdmfmklchghldaslsqkrra
    algdkfsryllamiarerkepgegmigavvaeygddatdeelrgfcvqvmlagddnisgm
    iglgvlamlrhpeqidafrgdeqsaqravdeliryltvpysptpriaredltlagqeikk
    gdsvicslpaanrdpalapdvdrldvtrepiphvafghgvhhclgaalarlelrtvftel
    wrrfpalrladpaqdtefrlttpaygltelmvaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lfkA (A:)
    dprplhirrqgldpadellaagaltrvtaethwmatahavvrqvmgdhqqfstrrrwdpe
    lvgnlmdydppehtrlrrkltpgftlrkmqrmapyieqivndrldemeragspadliafv
    adkvpgavlcelvgvprddrdmfmklchghldaslsqkrraalgdkfsryllamiarerk
    epgegmigavvaeygddatdeelrgfcvqvmlagddnisgmiglgvlamlrhpeqidafr
    gdeqsaqravdeliryltvpysptpriaredltlagqeikkgdsvicslpaanrdpalap
    dvdrldvtrepiphvafghgvhhclgaalarlelrtvftelwrrfpalrladpaqdtefr
    lttpaygltelmvaw