PDB entry 1lfj

View 1lfj on RCSB PDB site
Description: X-ray Crystal Structure of a Complex Formed Between Two Homologous Isoforms of Phospholipase A2 from Naja naja sagittifera: Principle of Molecular Association and Inactivation
Deposited on 2002-04-11, released 2003-05-20
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-20, with a file datestamp of 2003-05-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.212
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1lfja_
  • Chain 'B':
    Domains in SCOP 1.65: d1lfjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lfjA (A:)
ntyqfqnmiqctvpkrswrdfadygcycgrggsgtpiddldsccqvhdncynsareqggc
rpkqktytyqckagglscsgannscaattcdcdrlaaicfagapyndnnynidlkarcq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lfjB (B:)
nrwqfknmisctvpsrswwdfadygcycgrggsgtpsddldrccqthdncyneaekisgc
nprfrtysyactagtltctgrnnacaasvcdcdrnaaicfagapyndsnynidlqarcn