PDB entry 1lf9

View 1lf9 on RCSB PDB site
Description: crystal structure of bacterial glucoamylase complexed with acarbose
Class: hydrolase
Keywords: (alpha/alpha) barrel, 6 alpha-helical hairpin torroid, super beta sandwich, carbohydrase family GH15, acarbose, HYDROLASE
Deposited on 2002-04-10, released 2003-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.191
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucoamylase
    Species: Thermoanaerobacterium thermosaccharolyticum [TaxId:1517]
    Database cross-references and differences (RAF-indexed):
    • GB AAC24003 (Start-678)
      • see remark 999 (124)
      • conflict (251)
      • see remark 999 (679-683)
    Domains in SCOPe 2.06: d1lf9a1, d1lf9a2
  • Chain 'B':
    Compound: glucoamylase
    Species: Thermoanaerobacterium thermosaccharolyticum [TaxId:1517]
    Database cross-references and differences (RAF-indexed):
    • GB AAC24003 (Start-678)
      • see remark 999 (124)
      • conflict (251)
      • see remark 999 (679-683)
    Domains in SCOPe 2.06: d1lf9b1, d1lf9b2
  • Heterogens: ACR, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lf9A (A:)
    vlsgcsnnvssikidrfnnisavngpgeedtwasaqkqgvgtannyvskvwftlangais
    evyyptidtadvkeikfivtdgksfvpdetkdaiskvekftdkslgyklvntdkkgryri
    tkdiftdvkrnslimkakfealegsihdyklylaydphiknqgsynegyvikannnemlm
    akrdnvytalssnigwkgysigyykvndimtdldenkqmtkhydsargniiegaeidltk
    nsefeivlsfgqsdseaaktaletlgedynnlknnyidewtkycntlnnfngkanslyyn
    smmilkasedktnkgayiaslsipwgdgqrddntggyhlvwsrdlyhvanafiaagdvds
    anrsldylakvvkdngmipqntwisgkpywtgiqldeqadpiilsyrlkrydlydslvkp
    ladfiikigpktgqerweeiggyspatmaaevagltcaayiaeqnkdyesaqkyqekadn
    wqklidnltytengplgngqyyiriaglsdpdadfminiangggvydqkeivdpsflelv
    rlgvksaddpkilntlkvvdstikvdtpkgpswyrynhdgygepsktelyhgagkgrlwp
    lltgergmyeiaagkdatpyvkamekfaneggiiseqvwedtglptdsasplnwahaeyv
    ilfasniehkvldmpdivykryva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lf9A (A:)
    sikidrfnnisavngpgeedtwasaqkqgvgtannyvskvwftlangaisevyyptidta
    dvkeikfivtdgksfvpdetkdaiskvekftdkslgyklvntdkkgryritkdiftdvkr
    nslimkakfealegsihdyklylaydphiknqgsynegyvikannnemlmakrdnvytal
    ssnigwkgysigyykvndimtdldenkqmtkhydsargniiegaeidltknsefeivlsf
    gqsdseaaktaletlgedynnlknnyidewtkycntlnnfngkanslyynsmmilkased
    ktnkgayiaslsipwgdgqrddntggyhlvwsrdlyhvanafiaagdvdsanrsldylak
    vvkdngmipqntwisgkpywtgiqldeqadpiilsyrlkrydlydslvkpladfiikigp
    ktgqerweeiggyspatmaaevagltcaayiaeqnkdyesaqkyqekadnwqklidnlty
    tengplgngqyyiriaglsdpdadfminiangggvydqkeivdpsflelvrlgvksaddp
    kilntlkvvdstikvdtpkgpswyrynhdgygepsktelyhgagkgrlwplltgergmye
    iaagkdatpyvkamekfaneggiiseqvwedtglptdsasplnwahaeyvilfasniehk
    vldmpdivykryva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lf9B (B:)
    vlsgcsnnvssikidrfnnisavngpgeedtwasaqkqgvgtannyvskvwftlangais
    evyyptidtadvkeikfivtdgksfvpdetkdaiskvekftdkslgyklvntdkkgryri
    tkdiftdvkrnslimkakfealegsihdyklylaydphiknqgsynegyvikannnemlm
    akrdnvytalssnigwkgysigyykvndimtdldenkqmtkhydsargniiegaeidltk
    nsefeivlsfgqsdseaaktaletlgedynnlknnyidewtkycntlnnfngkanslyyn
    smmilkasedktnkgayiaslsipwgdgqrddntggyhlvwsrdlyhvanafiaagdvds
    anrsldylakvvkdngmipqntwisgkpywtgiqldeqadpiilsyrlkrydlydslvkp
    ladfiikigpktgqerweeiggyspatmaaevagltcaayiaeqnkdyesaqkyqekadn
    wqklidnltytengplgngqyyiriaglsdpdadfminiangggvydqkeivdpsflelv
    rlgvksaddpkilntlkvvdstikvdtpkgpswyrynhdgygepsktelyhgagkgrlwp
    lltgergmyeiaagkdatpyvkamekfaneggiiseqvwedtglptdsasplnwahaeyv
    ilfasniehkvldmpdivykryva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lf9B (B:)
    sikidrfnnisavngpgeedtwasaqkqgvgtannyvskvwftlangaisevyyptidta
    dvkeikfivtdgksfvpdetkdaiskvekftdkslgyklvntdkkgryritkdiftdvkr
    nslimkakfealegsihdyklylaydphiknqgsynegyvikannnemlmakrdnvytal
    ssnigwkgysigyykvndimtdldenkqmtkhydsargniiegaeidltknsefeivlsf
    gqsdseaaktaletlgedynnlknnyidewtkycntlnnfngkanslyynsmmilkased
    ktnkgayiaslsipwgdgqrddntggyhlvwsrdlyhvanafiaagdvdsanrsldylak
    vvkdngmipqntwisgkpywtgiqldeqadpiilsyrlkrydlydslvkpladfiikigp
    ktgqerweeiggyspatmaaevagltcaayiaeqnkdyesaqkyqekadnwqklidnlty
    tengplgngqyyiriaglsdpdadfminiangggvydqkeivdpsflelvrlgvksaddp
    kilntlkvvdstikvdtpkgpswyrynhdgygepsktelyhgagkgrlwplltgergmye
    iaagkdatpyvkamekfaneggiiseqvwedtglptdsasplnwahaeyvilfasniehk
    vldmpdivykryva