PDB entry 1lf9

View 1lf9 on RCSB PDB site
Description: crystal structure of bacterial glucoamylase complexed with acarbose
Deposited on 2002-04-10, released 2003-02-25
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-25, with a file datestamp of 2003-02-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lf9A (A:)
    sikidrfnnisavngpgeedtwasaqkqgvgtannyvskvwftlangaisevyyptidta
    dvkeikfivtdgksfvpdetkdaiskvekftdkslgyklvntdkkgryritkdiftdvkr
    nslimkakfealegsihdyklylaydphiknqgsynegyvikannnemlmakrdnvytal
    ssnigwkgysigyykvndimtdldenkqmtkhydsargniiegaeidltknsefeivlsf
    gqsdseaaktaletlgedynnlknnyidewtkycntlnnfngkanslyynsmmilkased
    ktnkgayiaslsipwgdgqrddntggyhlvwsrdlyhvanafiaagdvdsanrsldylak
    vvkdngmipqntwisgkpywtgiqldeqadpiilsyrlkrydlydslvkpladfiikigp
    ktgqerweeiggyspatmaaevagltcaayiaeqnkdyesaqkyqekadnwqklidnlty
    tengplgngqyyiriaglsdpdadfminiangggvydqkeivdpsflelvrlgvksaddp
    kilntlkvvdstikvdtpkgpswyrynhdgygepsktelyhgagkgrlwplltgergmye
    iaagkdatpyvkamekfaneggiiseqvwedtglptdsasplnwahaeyvilfasniehk
    vldmpdivykryva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lf9B (B:)
    sikidrfnnisavngpgeedtwasaqkqgvgtannyvskvwftlangaisevyyptidta
    dvkeikfivtdgksfvpdetkdaiskvekftdkslgyklvntdkkgryritkdiftdvkr
    nslimkakfealegsihdyklylaydphiknqgsynegyvikannnemlmakrdnvytal
    ssnigwkgysigyykvndimtdldenkqmtkhydsargniiegaeidltknsefeivlsf
    gqsdseaaktaletlgedynnlknnyidewtkycntlnnfngkanslyynsmmilkased
    ktnkgayiaslsipwgdgqrddntggyhlvwsrdlyhvanafiaagdvdsanrsldylak
    vvkdngmipqntwisgkpywtgiqldeqadpiilsyrlkrydlydslvkpladfiikigp
    ktgqerweeiggyspatmaaevagltcaayiaeqnkdyesaqkyqekadnwqklidnlty
    tengplgngqyyiriaglsdpdadfminiangggvydqkeivdpsflelvrlgvksaddp
    kilntlkvvdstikvdtpkgpswyrynhdgygepsktelyhgagkgrlwplltgergmye
    iaagkdatpyvkamekfaneggiiseqvwedtglptdsasplnwahaeyvilfasniehk
    vldmpdivykryva