PDB entry 1lf8

View 1lf8 on RCSB PDB site
Description: Complex of GGA3-VHS Domain and CI-MPR C-terminal Phosphopeptide
Class: signaling protein
Keywords: VHS domain, Protein-phosphopeptide complex, SIGNALING PROTEIN
Deposited on 2002-04-10, released 2002-06-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor binding protein gga3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lf8a_
  • Chain 'B':
    Compound: ADP-ribosylation factor binding protein gga3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ52 (5-End)
      • cloning artifact (3-4)
    Domains in SCOPe 2.05: d1lf8b_
  • Chain 'C':
    Compound: ADP-ribosylation factor binding protein gga3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1lf8c_
  • Chain 'D':
    Compound: ADP-ribosylation factor binding protein gga3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZ52 (5-End)
      • cloning artifact (3-4)
    Domains in SCOPe 2.05: d1lf8d_
  • Chain 'E':
    Compound: cation-independent mannose-6-phosphate receptor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11717 (Start-11)
      • modified residue (4)
  • Chain 'F':
    Compound: cation-independent mannose-6-phosphate receptor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11717 (Start-11)
      • modified residue (4)
  • Chain 'G':
    Compound: cation-independent mannose-6-phosphate receptor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11717 (Start-11)
      • modified residue (4)
  • Chain 'H':
    Compound: cation-independent mannose-6-phosphate receptor
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11717 (Start-11)
      • modified residue (4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lf8A (A:)
    gamgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiq
    spqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvi
    ellyswtmalpeeakikdayhmlkrqgivqsdppipvdrtlipsppprpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lf8A (A:)
    esleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspqewealqal
    tvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviellyswtmalp
    eeakikdayhmlkrqgivqsdppipvdrtli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lf8B (B:)
    gamgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiq
    spqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvi
    ellyswtmalpeeakikdayhmlkrqgivqsdppipvdrtlipsppprpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lf8B (B:)
    gsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspq
    ewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviell
    yswtmalpeeakikdayhmlkrqgivqsdppipvdrtli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lf8C (C:)
    gamgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiq
    spqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvi
    ellyswtmalpeeakikdayhmlkrqgivqsdppipvdrtlipsppprpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lf8C (C:)
    sleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspqewealqalt
    vleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviellyswtmalpe
    eakikdayhmlkrqgivqsdppipvdrtl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lf8D (D:)
    gamgsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiq
    spqewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkvi
    ellyswtmalpeeakikdayhmlkrqgivqsdppipvdrtlipsppprpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lf8D (D:)
    gsmaeaegesleswlnkatnpsnrqedweyiigfcdqinkelegpqiavrllahkiqspq
    ewealqaltvleacmkncgrrfhnevgkfrflnelikvvspkylgdrvsekvktkviell
    yswtmalpeeakikdayhmlkrqgivqsdppipvdrtli
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.