PDB entry 1lf6

View 1lf6 on RCSB PDB site
Description: crystal structure of bacterial glucoamylase
Deposited on 2002-04-10, released 2003-02-25
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-25, with a file datestamp of 2003-02-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lf6A (A:)
    sikidrfnnisavngpgeedtwasaqkqgvgtannyvskvwftlangaisevyyptidta
    dvkeikfivtdgksfvpdetkdaiskvekftdkslgyklvntdkkgryritkdiftdvkr
    nslimkakfealegsihdyklylaydphiknqgsynegyvikannnemlmakrdnvytal
    ssnigwkgysigyykvndimtdldenkqmtkhydsargniiegaeidltknsefeivlsf
    gqsdseaaktaletlgedynnlknnyidewtkycntlnnfngkanslyynsmmilkased
    ktnkgayiaslsipwgdgqrddntggyhlvwsrdlyhvanafiaagdvdsanrsldylak
    vvkdngmipqntwisgkpywtgiqldeqadpiilsyrlkrydlydslvkpladfiikigp
    ktgqerweeiggyspatmaaevagltcaayiaeqnkdyesaqkyqekadnwqklidnlty
    tengplgngqyyiriaglsdpdadfminiangggvydqkeivdpsflelvrlgvksaddp
    kilntlkvvdstikvdtpkgpswyrynhdgygepsktelyhgagkgrlwplltgergmye
    iaagkdatpyvkamekfaneggiiseqvwedtglptdsasplnwahaeyvilfasniehk
    vldmpdivykryva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lf6B (B:)
    sikidrfnnisavngpgeedtwasaqkqgvgtannyvskvwftlangaisevyyptidta
    dvkeikfivtdgksfvpdetkdaiskvekftdkslgyklvntdkkgryritkdiftdvkr
    nslimkakfealegsihdyklylaydphiknqgsynegyvikannnemlmakrdnvytal
    ssnigwkgysigyykvndimtdldenkqmtkhydsargniiegaeidltknsefeivlsf
    gqsdseaaktaletlgedynnlknnyidewtkycntlnnfngkanslyynsmmilkased
    ktnkgayiaslsipwgdgqrddntggyhlvwsrdlyhvanafiaagdvdsanrsldylak
    vvkdngmipqntwisgkpywtgiqldeqadpiilsyrlkrydlydslvkpladfiikigp
    ktgqerweeiggyspatmaaevagltcaayiaeqnkdyesaqkyqekadnwqklidnlty
    tengplgngqyyiriaglsdpdadfminiangggvydqkeivdpsflelvrlgvksaddp
    kilntlkvvdstikvdtpkgpswyrynhdgygepsktelyhgagkgrlwplltgergmye
    iaagkdatpyvkamekfaneggiiseqvwedtglptdsasplnwahaeyvilfasniehk
    vldmpdivykryva