PDB entry 1lf4

View 1lf4 on RCSB PDB site
Description: structure of plasmepsin II
Class: hydrolase
Keywords: hydrolase
Deposited on 2002-04-10, released 2002-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.217
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasmepsin 2
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lf4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lf4A (A:)
    lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
    dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
    tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
    egpltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvik
    vpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvpt
    filgdpfmrkyftvfdydnhsvgialakknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lf4A (A:)
    lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
    dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
    tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
    egpltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvif
    yvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdp
    fmrkyftvfdydnhsvgialakknl