PDB entry 1lf1

View 1lf1 on RCSB PDB site
Description:
Deposited on 2002-04-10, released 2002-07-03
The last revision prior to the SCOP 1.63 freeze date was dated 2002-07-03, with a file datestamp of 2002-07-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.183
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1lf1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lf1A (A:)
    svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwgitvfra
    amytssggyiddpsvkekvketveaaidlgiyviidwhilsdndpniykeeakdffdems
    elygdypnviyeianepngsdvtwdnqikpyaeevipvirdndpnnivivgtgtwsqdvh
    haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
    eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lf1A (A:)
    svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwgitvfra
    amytssggyiddpsvkekvketveaaidlgiyviidwhilsdndpniykeeakdffdems
    elygdypnviyeianepngsdvtwdnqikpyaeevipvirdndpnnivivgtgtwsqdvh
    haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatggvfldea
    qvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekir