PDB entry 1lf0

View 1lf0 on RCSB PDB site
Description: Crystal Structure of RasA59G in the GTP-bound form
Class: signaling protein
Keywords: Ras, GTPase, GTP, intermediate, SIGNALING PROTEIN
Deposited on 2002-04-10, released 2002-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.185
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transforming protein p21/h-ras-1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01112 (0-165)
    • engineered (58)
  Domains in SCOPe 2.08: d1lf0a_
• Heterogens: MG, CA, GNP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lf0A (A:)
  mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtgg
  qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
  aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh