PDB entry 1lew

View 1lew on RCSB PDB site
Description: crystal structure of map kinase p38 complexed to the docking site on its nuclear substrate mef2a
Class: transferase
Keywords: protein-peptide complex, transferase, map kinase, serine/threonine-protein kinase, p38, mef2a
Deposited on 2002-04-10, released 2002-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.215
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: P38
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lewa_
  • Chain 'B':
    Compound: myocyte-specific enhancer factor 2a
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lewA (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lewA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarvatrwyrapei
    mlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkisse
    sarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhd
    pddepvadpydqsfesrdllidewksltydevisfvpppld
    

  • Chain 'B':
    No sequence available.