PDB entry 1les

View 1les on RCSB PDB site
Description: lentil lectin complexed with sucrose
Deposited on 1995-08-23, released 1995-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1les.1
  • Chain 'B':
    Domains in SCOP 1.55: d1les.1
  • Chain 'C':
    Domains in SCOP 1.55: d1les.2
  • Chain 'D':
    Domains in SCOP 1.55: d1les.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lesA (A:)
    tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
    anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
    dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
    n
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lesB (B:)
    vtsytlnevvplkdvvpewvrigfsattgaefaahevhswsfhsqlg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lesC (C:)
    tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
    anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
    dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
    n
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lesD (D:)
    vtsytlnevvplkdvvpewvrigfsattgaefaahevhswsfhsqlg