PDB entry 1lep

View 1lep on RCSB PDB site
Description: three-dimensional structure of the immunodominant heat-shock protein chaperonin-10 of mycobacterium leprae
Class: chaperone
Keywords: chaperone, antigen, heat shock
Deposited on 1995-12-13, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.23
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chaperonin-10
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lepa_
  • Chain 'B':
    Compound: chaperonin-10
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lepb_
  • Chain 'C':
    Compound: chaperonin-10
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lepc_
  • Chain 'D':
    Compound: chaperonin-10
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lepd_
  • Chain 'E':
    Compound: chaperonin-10
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lepe_
  • Chain 'F':
    Compound: chaperonin-10
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lepf_
  • Chain 'G':
    Compound: chaperonin-10
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1lepg_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lepA (A:)
    akvkikpledkilvqageaetmtpsglvipenakekpqegtvvavgpgrwdedgakripv
    dvsegdiviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lepA (A:)
    akvkikpledkilvqaekpqegtvvavgpgrwdedgakripvdvsegdiviyskyggtei
    kyngeeylilsardvlavvsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lepB (B:)
    akvkikpledkilvqageaetmtpsglvipenakekpqegtvvavgpgrwdedgakripv
    dvsegdiviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lepB (B:)
    akvkikpledkilvqaekpqegtvvavgpgrwdedgakripvdvsegdiviyskyggtei
    kyngeeylilsardvlavvsk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lepC (C:)
    akvkikpledkilvqageaetmtpsglvipenakekpqegtvvavgpgrwdedgakripv
    dvsegdiviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lepC (C:)
    akvkikpledkilvqaekpqegtvvavgpgrwdedgakripvdvsegdiviyskyggtei
    kyngeeylilsardvlavvsk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lepD (D:)
    akvkikpledkilvqageaetmtpsglvipenakekpqegtvvavgpgrwdedgakripv
    dvsegdiviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lepD (D:)
    akvkikpledkilvqaekpqegtvvavgpgrwdedgakripvdvsegdiviyskyggtei
    kyngeeylilsardvlavvsk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1lepE (E:)
    akvkikpledkilvqageaetmtpsglvipenakekpqegtvvavgpgrwdedgakripv
    dvsegdiviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lepE (E:)
    akvkikpledkilvqaekpqegtvvavgpgrwdedgakripvdvsegdiviyskyggtei
    kyngeeylilsardvlavvsk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1lepF (F:)
    akvkikpledkilvqageaetmtpsglvipenakekpqegtvvavgpgrwdedgakripv
    dvsegdiviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lepF (F:)
    akvkikpledkilvqaekpqegtvvavgpgrwdedgakripvdvsegdiviyskyggtei
    kyngeeylilsardvlavvsk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1lepG (G:)
    akvkikpledkilvqageaetmtpsglvipenakekpqegtvvavgpgrwdedgakripv
    dvsegdiviyskyggteikyngeeylilsardvlavvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lepG (G:)
    akvkikpledkilvqaekpqegtvvavgpgrwdedgakripvdvsegdiviyskyggtei
    kyngeeylilsardvlavvsk