PDB entry 1leo

View 1leo on RCSB PDB site
Description: p100s nucleoside diphosphate kinase
Class: transferase
Keywords: enzyme, transferase, kinase
Deposited on 1996-05-22, released 1996-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.193
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (0-149)
      • engineered (94)
    Domains in SCOPe 2.07: d1leoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1leoA (A:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnslasapgsirgdfgvdvgrniihgsd
    svesanreialwfkpeelltevkpnpnlye