PDB entry 1len

View 1len on RCSB PDB site
Description: refinement of two crystal forms of lentil lectin at 1.8 angstroms resolution
Class: lectin
Keywords: lectin
Deposited on 1993-11-17, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Lens culinaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1len.1
  • Chain 'B':
    Compound: lectin
    Species: Lens culinaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1len.1
  • Chain 'C':
    Compound: lectin
    Species: Lens culinaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1len.2
  • Chain 'D':
    Compound: lectin
    Species: Lens culinaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1len.2
  • Heterogens: PO4, MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lenA (A:)
    tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
    anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
    dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lenB (B:)
    vtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlghtsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lenB (B:)
    vtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lenC (C:)
    tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
    anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
    dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lenD (D:)
    vtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlghtsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lenD (D:)
    vtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg