PDB entry 1lem

View 1lem on RCSB PDB site
Description: the monosaccharide binding site of lentil lectin: an x-ray and molecular modelling study
Class: lectin
Keywords: lectin
Deposited on 1993-11-17, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 3 Å
R-factor: 0.206
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Lens culinaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lem.1
  • Chain 'B':
    Compound: lectin
    Species: Lens culinaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1lem.1
  • Heterogens: GLC, CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lemA (A:)
tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
n

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1lemB (B:)
vtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlghtsks

    Sequence, based on observed residues (ATOM records): (download) 
    >1lemB (B:)
vtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg