PDB entry 1lel

View 1lel on RCSB PDB site
Description: The avidin BCAP complex
Class: unknown function
Keywords: avidin, streptavidin, biotin, ligand exchange
Deposited on 2002-04-10, released 2002-11-06
The last revision prior to the SCOP 1.73 freeze date was dated 2002-11-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.204
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOP 1.73: d1lela_
  • Chain 'B':
    Compound: Avidin
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOP 1.73: d1lelb_
  • Heterogens: NDG, BH7

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lelA (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lelA (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttakesplhgtentinkrtqptfgftvnw
    kfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lelB (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lelB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttaeikesplhgtentinkrtqptfgftv
    nwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl