PDB entry 1lei

View 1lei on RCSB PDB site
Description: The kB DNA sequence from the HLV-LTR functions as an allosteric regulator of HIV transcription
Class: transcription/DNA
Keywords: transcription factor, NF-kB/DNA complex, crystal structure, TRANSCRIPTION/DNA COMPLEX
Deposited on 2002-04-09, released 2003-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.25
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nuclear factor nf-kappa-b p65 subunit
    Species: Mus musculus [TaxId:10090]
    Gene: rela
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04207 (2-273)
      • cloning artifact (1)
    Domains in SCOPe 2.08: d1leia1, d1leia2, d1leia3
  • Chain 'B':
    Compound: nuclear factor nf-kappa-b p50 subunit
    Species: Mus musculus [TaxId:10090]
    Gene: NFKB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1leib1, d1leib2
  • Chain 'C':
    Compound: 5'-d(*cp*tp*cp*ap*gp*gp*gp*ap*ap*ap*gp*tp*ap*cp*ap*gp*a)-3'
  • Chain 'D':
    Compound: 5'-d(*tp*cp*tp*gp*5itp*ap*cp*5itp*5itp*5itp*cp*cp*cp*tp*gp*ap*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1leiA (A:)
    mayveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislv
    tkdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtn
    nnpfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapntaelkic
    rvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaivfrtppy
    adpslqapvrvsmqlrrpsdrelsepmefqylpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1leiA (A:)
    ayveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
    kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
    npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapntaelkicr
    vnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaivfrtppya
    dpslqapvrvsmqlrrpsdrelsepmefqylpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1leiB (B:)
    mgpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivql
    vtngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmte
    acirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftaf
    lpdstgsftrrlepvvsdaiydskapnasnlkivrmdrtagcvtggeeiyllcdkvqkdd
    iqirfyeeeenggvwegfgdfsptdvhrqfaivfktpkykdvnitkpasvfvqlrrksdl
    etsepkpflyype
    

    Sequence, based on observed residues (ATOM records): (download)
    >1leiB (B:)
    gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
    tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
    cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
    pdstgsftrrlepvvsdaiydskapnasnlkivrmdrtagcvtggeeiyllcdkvqkddi
    qirfyeeeenggvwegfgdfsptdvhrqfaivfktpkykdvnitkpasvfvqlrrksdle
    tsepkpflyype
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.