PDB entry 1leh

View 1leh on RCSB PDB site
Description: leucine dehydrogenase from bacillus sphaericus
Deposited on 1995-06-09, released 1996-12-23
The last revision prior to the SCOP 1.69 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lehA (A:)
    meifkymekydyeqlvfcqdeasglkaviaihdttlgpalggarmwtynaeeeaiedalr
    largmtyknaaaglnlgggktviigdpfadknedmfralgrfiqglngryitaedvgttv
    ddmdlihqetdyvtgispafgssgnpspvtaygvyrgmkaaakeafgsdsleglavsvqg
    lgnvakalckklntegaklvvtdvnkaavsaavaeegadavapnaiygvtcdifapcalg
    avlndftipqlkakviagsadnqlkdprhgkylhelgivyapdyvinaggvinvadelyg
    ynrtramkrvdgiydsiekifaiskrdgvpsyvaadrmaeeriakvakarsqflqdqrni
    lngr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lehB (B:)
    meifkymekydyeqlvfcqdeasglkaviaihdttlgpalggarmwtynaeeeaiedalr
    largmtyknaaaglnlgggktviigdpfadknedmfralgrfiqglngryitaedvgttv
    ddmdlihqetdyvtgispafgssgnpspvtaygvyrgmkaaakeafgsdsleglavsvqg
    lgnvakalckklntegaklvvtdvnkaavsaavaeegadavapnaiygvtcdifapcalg
    avlndftipqlkakviagsadnqlkdprhgkylhelgivyapdyvinaggvinvadelyg
    ynrtramkrvdgiydsiekifaiskrdgvpsyvaadrmaeeriakvakarsqflqdqrni
    lngr