PDB entry 1lee

View 1lee on RCSB PDB site
Description: crystal structure of plasmepsin from p. falciparum in complex with inhibitor rs367
Class: hydrolase
Keywords: plasmepsin, aspartic protease, plasmodium falciparum, HYDROLASE
Deposited on 2002-04-09, released 2002-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.236
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasmepsin 2
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46925 (0-330)
      • engineered (206)
    Domains in SCOPe 2.07: d1leea_
  • Heterogens: R36, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1leeA (A:)
    lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
    dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
    tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
    egpltyeklnhdlywqitldahvgnislekancivdsgtsaitvptdflnkmlqnldvik
    vpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvpt
    filgdpfmrkyftvfdydnhsvgialakknl