PDB entry 1led

View 1led on RCSB PDB site
Description: structures of the lectin IV of griffonia simplicifolia and its complex with the lewis b human blood group determinant at 2.0 angstroms resolution
Class: lectin
Keywords: lectin
Deposited on 1992-12-17, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: west-central african legume lectin IV
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1leda_
  • Heterogens: MN, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ledA (A:)
    entvnftypdfwsyslkngteitflgdatripgalqltktdangnpvrssagqasysepv
    flwdstgkaasfytsftfllknygaptadglafflapvdssvkdyggflglfrhetaadp
    sknqvvavefdtwinkdwndppyphigidvnsivsvattrwenddaygssiatahityda
    rskiltvllsyehgrdyilshvvdlakvlpqkvrigfsagvgydevtyilswhffstldg
    tnk