PDB entry 1lec

View 1lec on RCSB PDB site
Description: structures of the lectin iv of griffonia simplicifolia and its complex with the lewis b human blood group determinant at 2.0 angstroms resolution
Deposited on 1992-12-17, released 1994-01-31
The last revision prior to the SCOP 1.67 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1lec__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lec_ (-)
    entvnftypdfwsyslkngteitflgdatripgalqltktdangnpvrssagqasysepv
    flwdstgkaasfytsftfllknygaptadglafflapvdssvkdyggflglfrhetaadp
    sknqvvavefdtwinkdwndppyphigidvnsivsvattrwenddaygssiatahityda
    rskiltvllsyehgrdyilshvvdlakvlpqkvrigfsagvgydevtyilswhffstldg
    tnk