PDB entry 1le7

View 1le7 on RCSB PDB site
Description: CARBOXYLIC ESTER HYDROLASE, C 2 2 21 space group
Class: hydrolase
Keywords: Human Phosphatidylcholine 2-acylhydrolase GX, GX sPLA2, sPLA2-X
Deposited on 2002-04-09, released 2002-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.211
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Group X Secretory Phospholipase A2
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2GX10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1le7a_
  • Chain 'B':
    Compound: Group X Secretory Phospholipase A2
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2GX10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1le7b_
  • Heterogens: CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1le7A (A:)
    gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
    kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
    kcd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1le7B (B:)
    gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
    kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
    kcd