PDB entry 1le2

View 1le2 on RCSB PDB site
Description: structural basis for altered function in the common mutants of human apolipoprotein-e
Class: lipoprotein
Keywords: lipoprotein
Deposited on 1991-08-22, released 1992-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.195
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: apolipoprotein e2
  Species: Homo sapiens [TaxId:9606]
  Gene: E2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02649 (0-143)
    • conflict (135)
  Domains in SCOPe 2.07: d1le2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1le2A (A:)
  gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
  tpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlr
  klrkrllrdaddlqkclavyqaga