PDB entry 1ldr

View 1ldr on RCSB PDB site
Description: second repeat of the ldl receptor ligand-binding domain
Deposited on 1995-08-17, released 1996-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ldr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ldr_ (-)
    lsvtcksgdfscggrvnrcipqfwrcdgqvdcdngsdeqgc