PDB entry 1ldq

View 1ldq on RCSB PDB site
Description: avidin-homobiotin complex
Class: unknown function
Keywords: avidin, streptavidin, biotin, ligand exchange, UNKNOWN FUNCTION
Deposited on 2002-04-09, released 2002-11-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.201
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOPe 2.05: d1ldqa_
  • Chain 'B':
    Compound: Avidin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOPe 2.05: d1ldqb_
  • Heterogens: NDG, SHM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ldqA (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldqA (A:)
    csltgkwtndlgsnmtigavnsrgeftgtyttaikesplhgtentinkrtqptfgftvnw
    kfsesttvftgqcfidgkevlktmwllrssvndigddwkatrvginiftrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ldqB (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldqB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttaesplhgtentinkrtqptfgftvnwk
    fsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl