PDB entry 1ldo

View 1ldo on RCSB PDB site
Description: avidin-norbioitn complex
Class: unknown function
Keywords: avidin, streptavidin, biotin, high affinity systems, ligand exchange
Deposited on 2002-04-09, released 2002-11-06
The last revision prior to the SCOP 1.73 freeze date was dated 2002-11-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avidin
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOP 1.73: d1ldoa_
  • Chain 'B':
    Compound: Avidin
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02701
      • conflict (33)
    Domains in SCOP 1.73: d1ldob_
  • Heterogens: NDG, SNR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ldoA (A:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldoA (A:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ldoB (B:)
    arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
    qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
    trlrtqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldoB (B:)
    kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
    tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
    l