PDB entry 1ldn

View 1ldn on RCSB PDB site
Description: structure of a ternary complex of an allosteric lactate dehydrogenase from bacillus stearothermophilus at 2.5 angstroms resolution
Class: oxidoreductase(choh(d)-nad(a))
Keywords: oxidoreductase(choh(d)-nad(a))
Deposited on 1991-11-19, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.157
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldna1, d1ldna2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldnb1, d1ldnb2
  • Chain 'C':
    Compound: l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldnc1, d1ldnc2
  • Chain 'D':
    Compound: l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldnd1, d1ldnd2
  • Chain 'E':
    Compound: l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldne1, d1ldne2
  • Chain 'F':
    Compound: l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldnf1, d1ldnf2
  • Chain 'G':
    Compound: l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldng1, d1ldng2
  • Chain 'H':
    Compound: l-lactate dehydrogenase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldnh1, d1ldnh2
  • Heterogens: FBP, OXM, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ldnA (A:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraft
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ldnB (B:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraft
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ldnC (C:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraft
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ldnD (D:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraft
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ldnE (E:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraft
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ldnF (F:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraft
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ldnG (G:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraft
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ldnH (H:)
    mknnggarvvvigagfvgasyvfalmnqgiadeivlidaneskaigdamdfnhgkvfapk
    pvdiwhgdyddcrdadlvvicaganqkpgetrldlvdkniaifrsivesvmasgfqglfl
    vatnpvdiltyatwkfsglphervigsgtildtarfrfllgeyfsvapqnvhayiigehg
    dtelpvwsqayigvmpirklveskgeeaqkdlerifvnvrdaayqiiekkgatyygiamg
    larvtrailhnenailtvsayldglygerdvyigvpavinrngirevieielnddeknrf
    hhsaatlksvlaraft