PDB entry 1ldl

View 1ldl on RCSB PDB site
Description: three-dimensional structure of a cysteine-rich repeat from the low-density lipoprotein receptor
Class: binding protein
Keywords: ldl receptor cysteine-rich repeat, binding protein
Deposited on 1995-03-20, released 1996-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: low-density lipoprotein receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Human
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ldla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ldlA (A:)
    gsavgdrcernefqcqdgkcisykwvcdgsaecqdgsdesqetclsvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldlA (A:)
    avgdrcernefqcqdgkcisykwvcdgsaecqdgsdesqetclsvt