PDB entry 1ldk

View 1ldk on RCSB PDB site
Description: Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF Ubiquitin Ligase Complex
Class: ligase
Keywords: SCF, cullin, rbx1, roc1, hrt1, skp1, skp2, F-box, fbox, ubiquitin, ubiquitination, E3 ligase
Deposited on 2002-04-08, released 2002-05-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.289
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cullin homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldka_
  • Chain 'B':
    Compound: cullin homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldkb1, d1ldkb2
  • Chain 'C':
    Compound: RING-box protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldkc_
  • Chain 'D':
    Compound: cyclin a/cdk2-associated protein p19
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldkd1, d1ldkd2
  • Chain 'E':
    Compound: SKP2-like protein type gamma
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ldke1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ldkA (A:)
    igldqiwddlragiqqvytrqsmaksrymelythvynyctsvhqsnqargagvppskskk
    gqtpggaqfvglelykrlkeflknyltnllkdgedlmdesvlkfytqqwedyrfsskvln
    gicaylnrhwvrrecdegrkgiyeiyslalvtwrdclfrplnkqvtnavlkliekernge
    tintrlisgvvqsyvelglneddafakgptltvykesfesqfladterfytresteflqq
    npvteymkkaearlleeqrrvqvylhestqdelarkceqvliekhleifhtefqnlldad
    knedlgrmynlvsriqdglgelkkllethihnqglaaiekcgeaalndpkmyvqtvldvh
    kkynalvmsafnndagfvaaldkacgrfinnnavtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldkA (A:)
    igldqiwddlragiqqvytrqsmaksrymelythvynyctsqfvglelykrlkeflknyl
    tnllkdgedlmdesvlkfytqqwedyrfsskvlngicaylnrhwvrreckgiyeiyslal
    vtwrdclfrplnkqvtnavlkliekerngetintrlisgvvqsyvelglnedltvykesf
    esqfladterfytresteflqqnpvteymkkaearlleeqrrvqvylhestqdelarkce
    qvliekhleifhtefqnlldadknedlgrmynlvsriqdglgelkkllethihnqglaai
    ekcgeaalndpkmyvqtvldvhkkynalvmsafnndagfvaaldkacgrfinnnavtk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ldkB (B:)
    maqssskspellarycdsllkkssknpeeaeledtlnqvmvvfkyiedkdvfqkfyakml
    akrlvhqnsasddaeasmisklkqacgfeytsklqrmfqdigvskdlneqfkkhltnsep
    ldldfsiqvlssgswpfqqsctfalpselersyqrftafyasrhsgrkltwlyqlskgel
    vtncfknrytlqastfqmaillqyntedaytvqqltdstqikmdilaqvlqillkskllv
    ledenanvdevelkpdtliklylgyknkklrvninvpmkteqkqeqetthknieedrkll
    iqaaivrimkmrkvlkhqqllgevltqlssrfkprvpvikkcidiliekeylervdgekd
    tysyla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ldkC (C:)
    kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
    fhfhcisrwlktrqvcpldnrewefqkygh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldkC (C:)
    kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha
    fhfhcisrwlktrqvcpldnrewefqky
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ldkD (D:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    dppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmi
    kgktpeeirktfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldkD (D:)
    psiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhkd
    ddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ldkE (E:)
    wdslpdelllgifsclclpellkvsgvckrwyrlasdeslw