PDB entry 1ldd

View 1ldd on RCSB PDB site
Description: Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF Ubiquitin Ligase Complex
Class: ligase
Keywords: ubiquitin, ligase, ubiquitination, RING finger, winged-helix
Deposited on 2002-04-08, released 2002-05-08
The last revision prior to the SCOP 1.75 freeze date was dated 2002-05-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anaphase Promoting Complex
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ldda_
  • Chain 'B':
    Compound: Anaphase Promoting Complex
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1lddb_
  • Chain 'C':
    Compound: Anaphase Promoting Complex
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1lddc_
  • Chain 'D':
    Compound: Anaphase Promoting Complex
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1lddd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lddA (A:)
    kyeltlqrslpfiegmltnlgamklhkihsflkitvpkdwgynritlqqlegylntlade
    grlkyiangsyeiv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lddB (B:)
    kyeltlqrslpfiegmltnlgamklhkihsflkitvpkdwgynritlqqlegylntlade
    grlkyiangsyeiv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lddC (C:)
    kyeltlqrslpfiegmltnlgamklhkihsflkitvpkdwgynritlqqlegylntlade
    grlkyiangsyeiv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lddD (D:)
    kyeltlqrslpfiegmltnlgamklhkihsflkitvpkdwgynritlqqlegylntlade
    grlkyiangsyeiv