PDB entry 1ldc

View 1ldc on RCSB PDB site
Description: x-ray structure of two complexes of the y143f flavocytochrome b2 mutant crystallized in the presence of lactate or phenyl-lactate
Deposited on 1995-04-13, released 1995-07-10
The last revision prior to the SCOP 1.69 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.195
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ldcA (A:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawafyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldcA (A:)
    kispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifeplhapn
    vidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppldniinlydfe
    ylasqtltkqawafyssgandevthrenhnayhriffkpkilvdvrkvdistdmlgshvd
    vpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiieaapsdkqiq
    wyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkalskfidpsltwk
    dieelkkktklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmp
    ileqrnlkdklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaiei
    lrdeiemsmrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ldcB (B:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawafyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldcB (B:)
    tkediarkeqlksllppldniinlydfeylasqtltkqawafyssgandevthrenhnay
    hriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvt
    kvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
    dapslgqrekdmklkfidpsltwkdieelkkktklpivikgvqrtedvikaaeigvsgvv
    lsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkalclgakgv
    glgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlstlkartvg
    vpndvlynevyegptltefeda