PDB entry 1ldc

View 1ldc on RCSB PDB site
Description: x-ray structure of two complexes of the y143f flavocytochrome b2 mutant crystallized in the presence of lactate or phenyl-lactate
Class: oxidoreductase
Keywords: flavoenzyme, oxidoreductase
Deposited on 1995-04-13, released 1995-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.195
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00175 (Start-510)
      • engineered mutation (142)
    Domains in SCOPe 2.08: d1ldca1, d1ldca2
  • Chain 'B':
    Compound: l-lactate dehydrogenase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PGR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00175 (Start-510)
      • engineered mutation (142)
    Domains in SCOPe 2.08: d1ldcb_
  • Heterogens: FMN, HEM, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ldcA (A:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawafyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldcA (A:)
    kispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvtaifeplhapn
    vidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppldniinlydfe
    ylasqtltkqawafyssgandevthrenhnayhriffkpkilvdvrkvdistdmlgshvd
    vpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiieaapsdkqiq
    wyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkalskfidpsltwk
    dieelkkktklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmp
    ileqrnlkdklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaiei
    lrdeiemsmrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ldcB (B:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawafyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ldcB (B:)
    tkediarkeqlksllppldniinlydfeylasqtltkqawafyssgandevthrenhnay
    hriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvt
    kvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
    dapslgqrekdmklkfidpsltwkdieelkkktklpivikgvqrtedvikaaeigvsgvv
    lsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkalclgakgv
    glgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlstlkartvg
    vpndvlynevyegptltefeda