PDB entry 1ld8

View 1ld8 on RCSB PDB site
Description: Co-crystal structure of Human Farnesyltransferase with farnesyldiphosphate and inhibitor compound 49
Class: transferase
Keywords: alpha-alpha barrel, inhibitor, ftase, pftase, fpp, caax, ras, TRANSFERASE
Deposited on 2002-04-08, released 2002-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein farnesyltransferase alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ld8a_
  • Chain 'B':
    Compound: Protein farnesyltransferase beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ld8b_
  • Heterogens: SUC, ZN, FPP, U49, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ld8A (A:)
    maategvgeaaqggepgqpaqpppqphppppqqqhkeemaaeageavaspmddgfvslds
    psyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrvlvewlr
    dpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnnsvwnqr
    yfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhstendsptnvqqeef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ld8A (A:)
    fvsldspsyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrv
    lvewlrdpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnn
    svwnqryfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ld8B (B:)
    maspssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfs
    sykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldepipq
    ivatdvcqflelcqspeggfgggpgqyphlaptyaavnalciigteeaydiinrekllqy
    lyslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggig
    gvpgmeahggytfcglaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcy
    sfwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdf
    yhtcyclsglsiaqhfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpv
    pgfeelkdetsaepatd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ld8B (B:)
    pvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqre
    khfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqsp
    eggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmhvg
    gevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcgl
    aalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralh
    aqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhf
    gsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgf